PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g083390.3
Common NameMTR_4g083390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family B3
Protein Properties Length: 150aa    MW: 16982.3 Da    PI: 4.5965
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g083390.3genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B336.68.2e-12471053796
                      EEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
               B3  37 tledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                      t+   +g+sW ++++ ++k +++  +  W++F+++n Lk gD +vF+l+++se+e v+kv
  Medtr4g083390.3  47 TILKYRGKSWGMTYNGQNKTKQF-DSVSWEKFAEDNYLKLGDACVFELMKNSEEEIVFKV 105
                      556789********766666665.5669*********************99999998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.4E-1311109IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-1212109IPR015300DNA-binding pseudobarrel domain
CDDcd100171.97E-1013109No hitNo description
SMARTSM010191.2E-415111IPR003340B3 DNA binding domain
PfamPF023621.3E-946105IPR003340B3 DNA binding domain
PROSITE profilePS5086310.60247111IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MQTGGIEPLT GEPYFHVVLS KTHLSTRYGM GPSSSICEEL PSKEVPTILK YRGKSWGMTY  60
NGQNKTKQFD SVSWEKFAED NYLKLGDACV FELMKNSEEE IVFKVQILRG EEEPILLSEF  120
PGTAEANLSW LEIHLPLWDC SRLQDTFVL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.51980.0flower| glandular trichome| leaf| root| seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2024671e-156AC202467.11 Medicago truncatula clone mth2-13m8, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003607834.21e-108B3 DNA-binding domain protein
TrEMBLG7JHL41e-108G7JHL4_MEDTR; B3 DNA-binding domain protein
STRINGGLYMA07G35040.22e-35(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.12e-06B3 family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]